Kanchimuttseva.org valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
Meta Tags
| Title | KanchiMuttSeva - Donate Online to Kanchi Mutt |
| Description | Portal to facilitate online donations to Sri Kanchi Kamakoti Peetam, Kanchipuram (Kanchi Mutt). |
| Keywords | Donate to Kanchi Mutt, Kanchi Kamakoti, Jagadguru Shankaracharya, Online Donations, Hinduism, Mahaperiyava, Shankaracharya, Village Temple Renovation, Donation to Kanchi, Bikshavandanam, Annadaanam, Donate for poor feeding, Annadaanam, Go-samrakshanam, Contribute to Feed cattle |
Server Information
| WebSite | |
| Host IP | 166.62.10.47 |
| Location | Scottsdale, Arizona, United States |
Related Websites
| Site | Rank |
| nseva.org | #1,965,960 |
| theindianscene.com | #3,128,472 |
| srikanchimahaswamividyamandir.org | #7,344,507 |
More to Explore
| kbcpclaw.com |
| kcpkr.synology.me |
| kellenmart.com |
| kennethpool.com |
| keystonegroup.co.uk |
| kidstream.tv |
| kirstenklug.com |
| kisansammannidhi.com |
| kissfillingmachine.com |
| klarkteknik.com |
| whiteoakfx.com |
| wild.as |
Kanchimuttseva.org Valuation
|
US$10,184
Last updated: Apr 4, 2021
Kanchimuttseva.org has global traffic rank of 3,335,333. Kanchimuttseva.org has an estimated worth of US$ 10,184, based on its estimated Ads revenue. Kanchimuttseva.org receives approximately 930 unique visitors each day. Its web server is located in Scottsdale, Arizona, United States, with IP address 166.62.10.47. According to SiteAdvisor, kanchimuttseva.org is safe to visit. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$10,184 |
| Daily Ads Revenue | US$5 |
| Monthly Ads Revenue | US$167 |
| Yearly Ads Revenue | US$2,036 |
| Daily Unique Visitors | 930 |
| Note: All traffic and earnings values are estimates. | |
Traffic Ranks
| Global Rank | 3,335,333 |
| Delta (90 Days) | 0 |
| Most Popular In Country | N/A |
| Country Rank | N/A |
DNS Records
| Host | Type | TTL | Data |
| kanchimuttseva.org | A | 10799 | IP: 166.62.10.47 |
| kanchimuttseva.org | MX | 3599 | Priority: 0 Target: mail.kanchimuttseva.org. |
| kanchimuttseva.org | NS | 3599 | Target: ns39.domaincontrol.com. |
| kanchimuttseva.org | NS | 3599 | Target: ns40.domaincontrol.com. |
| kanchimuttseva.org | TXT | 3599 | TXT: google-site-verification=c8GArjlCdbhhSm2Rl53HJvgDjhpebUQpiP7bvyb0dGk |
| kanchimuttseva.org | TXT | 3599 | TXT: v=spf1 a mx ptr include:secureserver.net ~all |
| kanchimuttseva.org | TXT | 3599 | TXT: google-site-verification=SveeGqukXdVbCJASdFcFfySAsTkOd91mkDrV2ETg_oA |
| kanchimuttseva.org | SOA | 599 | MNAME: ns39.domaincontrol.com. RNAME: dns.jomax.net. Serial: 2020110400 Refresh: 28800 Retry: 7200 Expire: 604800 Minimum TTL: 600 |
HTTP Headers
HTTP/1.1 200 OK Date: Sun, 04 Apr 2021 19:42:46 GMT Server: Apache X-Powered-By: PHP/7.4.11 Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate Pragma: no-cache Set-Cookie: PHPSESSID=3d561a862ed968b5d297dd57ce858cc5; path=/ Upgrade: h2,h2c Connection: Upgrade Vary: Accept-Encoding,User-Agent Transfer-Encoding: chunked Content-Type: text/html; charset=UTF-8 |
Kanchimuttseva.org Whois Information
Domain Name: KANCHIMUTTSEVA.ORG Registry Domain ID: D402200000002007896-LROR Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.whois.godaddy.com Updated Date: 2020-04-09T14:52:20Z Creation Date: 2017-04-08T08:38:59Z Registry Expiry Date: 2021-04-08T08:38:59Z Registrar Registration Expiration Date: Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Reseller: Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited Registrant Organization: Registrant State/Province: Tamil Nadu Registrant Country: IN Name Server: NS39.DOMAINCONTROL.COM Name Server: NS40.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form https://www.icann.org/wicf/) |